Native Human interferon alpha therapeutic protein (Interferon alfa-n1)
| Cat.No. : | Interferon alfa-P031H |
| Product Overview : | Purified, natural (n is for natural) glycosylated human interferon alpha proteins 166 residues. For treatment of venereal or genital warts caused by the Human Papiloma Virus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Description : | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
| CAS number : | 74899-72-2 |
| Molecular Mass : | 19.24kDa |
| AA Sequence : | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKD SSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEV VRAEIMRSFSLSTNLQESLRSKE |
| Endotoxin : | < 0.1 eu per μg of the |
| Purity : | >95% |
| ◆ Native Proteins | ||
| Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
| Interferon alfa-P029H | Native Human interferon alpha therapeutic protein (Interferon alfa-n3) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Interferon alfa Products
Required fields are marked with *
My Review for All Interferon alfa Products
Required fields are marked with *



