Recombinant A. baylyi Catechol 1,2-dioxygenase Protein, His-SUMO-tagged
| Cat.No. : | catA-1151A |
| Product Overview : | Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase (1-311aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | A.baylyi |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-311 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 50.3 kDa |
| AA Sequence : | MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Catechol 1,2-dioxygenase |
| Official Symbol | Catechol 1,2-dioxygenase |
| Synonyms | Catechol 1,2-dioxygenase; 1,2-CTD; EC= 1.13.11.1; EC 1.13.11.1; catA |
| UniProt ID | P07773 |
| ◆ Recombinant Proteins | ||
| catA-1151A | Recombinant A. baylyi Catechol 1,2-dioxygenase Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Catechol 1,2-dioxygenase Products
Required fields are marked with *
My Review for All Catechol 1,2-dioxygenase Products
Required fields are marked with *
