Recombinant A. giganteus AFP Protein, His-B2M-tagged
| Cat.No. : | AFP-1109A |
| Product Overview : | Recombinant Aspergillus giganteus AFP Protein (44-94aa) was expressed in E. coli with N-terminal His-B2M-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | A.giganteus |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 44-94 a.a. |
| Description : | This protein inhibits the growth of a variety of fungal species. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 19.8 kDa |
| AA Sequence : | ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Antifungal protein |
| Official Symbol | Antifungal protein |
| Synonyms | Antifungal protein; AFP; antifungal protein Afp; |
| UniProt ID | P17737 |
| ◆ Recombinant Proteins | ||
| AFP-1109A | Recombinant A. giganteus AFP Protein, His-B2M-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Antifungal protein Products
Required fields are marked with *
My Review for All Antifungal protein Products
Required fields are marked with *
Recently Viewed
