Recombinant A. niger Aspergillopepsin-2 Protein, His-SUMO-tagged

• Cat.No.: Asp-1135A
• Product Overview: Recombinant Aspergillus niger Aspergillopepsin-2 Protein (60-98 aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: A.niger
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 60-98 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 19.9 kDa
• AA Sequence: EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Aspergillopepsin-2
• Official Symbol: Aspergillopepsin-2
• Synonyms: Aspergillopepsin-2; EC 3.4.23.19; Acid protease A Aspergillopepsin II Proctase A; Aspergillopepsin II light chain; Aspergillopepsin-2 heavy chain; Aspergillopepsin 2
• UniProt ID: P24665