Recombinant A. niger Aspergillopepsin-2 Protein, His-SUMO-tagged
Cat.No. : |
Asp-1135A |
Product Overview : |
Recombinant Aspergillus niger Aspergillopepsin-2 Protein (60-98 aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
Source : |
E. coli |
Species : |
A. niger |
Tag : |
His-SUMO |
Form : |
Tris-based buffer, 50% glycerol. |
Molecular Mass : |
19.9 kDa |
AA Sequence : |
EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY |
Purity : |
Greater than 90% as determined by SDS-PAGE. |
Storage : |
The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name : |
Aspergillopepsin-2 |
Official Symbol : |
Aspergillopepsin-2 |
Synonyms : |
Aspergillopepsin-2; EC 3.4.23.19; Acid protease A Aspergillopepsin II Proctase A; Aspergillopepsin II light chain; Aspergillopepsin-2 heavy chain; Aspergillopepsin 2 |
UniProt ID : |
P24665 |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.