Recombinant A. thaliana OSM34 Protein, His-SUMO/MYC-tagged
| Cat.No. : | OSM34-1313H |
| Product Overview : | Recombinant A. thaliana OSM34 Protein (23-244aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | A.thaliana |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 23-244 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 44.4 kDa |
| AA Sequence : | ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQ CTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCN NPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGS HQLPIKMVTEEN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | OSM34 osmotin 34 [ Arabidopsis thaliana (thale cress) ] |
| Official Symbol | OSM34 |
| Synonyms | ATOSM34; osmotin 34; T5C23.80; T5C23_80; OSM34 |
| Gene ID | 826770 |
| mRNA Refseq | NM_117234.3 |
| Protein Refseq | NP_192902.1 |
| UniProt ID | P50700 |
| ◆ Recombinant Proteins | ||
| OSM34-1313H | Recombinant A. thaliana OSM34 Protein, His-SUMO/MYC-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSM34 Products
Required fields are marked with *
My Review for All OSM34 Products
Required fields are marked with *
