Recombinant Absidia Glauca ACT1 Protein (1-140 aa), His-Myc-tagged

Cat.No. : ACT1-2378A
Product Overview : Recombinant Absidia Glauca (Pin mould) ACT1 Protein (1-140 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Absidia Glauca
Source : E.coli
Tag : His&Myc
Protein Length : 1-140 aa
Description : Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.2 kDa
AA Sequence : MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms ACT1;
UniProt ID P10982

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACT1 Products

Required fields are marked with *

My Review for All ACT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon