Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein
| Cat.No. : | BDGL_002355-151A |
| Product Overview : | Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Acinetobacter calcoaceticus |
| Source : | E.coli |
| Description : | putative outer membrane protein |
| Form : | 50mM Tris-HCl, pH 8.0, 200mM NaCl. |
| Molecular Mass : | ~33 kDa |
| AA Sequence : | AENENVEKLETIRIKAHPLEQTSKDFAVADTVVDQKHLTEGAATIGDALNSEVGIYANQFGAGSSRPVIRGQDGPRVKVLQNSSENVDVSTLSPDHAVTVDPVLAKQVEVIRGPSTLLFGAGTVGGLVNVIDNKIPTQMPENGYEGQVGLRYNTGSDEKLASAGVTVGLGSQVALRVEGLTRDANNYIAPNYIHEGEKERRVDNTFAQGDSVNVGLSWIYDRGYTGISYSNRRDQYGLPGHSHEYESCSAHLGGRPHLHCDAHEHDHEEGEEAHAHEEHEHEH |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Gene Name | BDGL_002355 putative outer membrane protein [ Acinetobacter pittii PHEA-2 ] |
| Official Symbol | BDGL_002355 |
| Gene ID | 11636886 |
| Protein Refseq | YP_004996623 |
| UniProt ID | F0KNW6 |
| ◆ Recombinant Proteins | ||
| BDGL_002355-152A | Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein | +Inquiry |
| BDGL_002355-151A | Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein | +Inquiry |
| BDGL_002355-153A | Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BDGL_002355 Products
Required fields are marked with *
My Review for All BDGL_002355 Products
Required fields are marked with *



