Recombinant Actinoplanes Utahensis AAC Protein (35-214 aa), His-SUMO-tagged
Cat.No. : | AAC-1790A |
Product Overview : | Recombinant Actinoplanes Utahensis AAC Protein (35-214 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Actinoplanes Utahensis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 35-214 aa |
Description : | Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.1 kDa |
AA Sequence : | GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | aac; Aculeacin-A acylase small subunit Aculeacin-A acylase large subunit; |
UniProt ID | P29958 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAC Products
Required fields are marked with *
My Review for All AAC Products
Required fields are marked with *