Recombinant Active Human ATAD2B Protein (953 to 1080), C-6×His tagged

Cat.No. : ATAD2B-12H
Product Overview : Recombinant Active Human ATAD2B Protein (953-1080) with C-6×His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 953 to 1080
Description : The protein encoded by this gene belongs to the AAA ATPase family. This family member includes an N-terminal bromodomain. It has been found to be localized to the nucleus, partly to replication sites, consistent with a chromatin-related function. Alternative splicing of this gene results in multiple transcript variants.
Form : Liquid
Molecular Mass : Predicted molecular weight: 42 kDa including tags
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKE
Purity : > 95% SDS-PAGE
Applications : Functional Studies, SDS-PAGE
Storage Buffer : pH: 8
Constituents: 0.48% Tris, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride
This product is an active protein and may elicit a biological response in vivo, handle with caution.
Shipping : Shipped on Dry Ice. Store at -80 centigrade. Avoid freeze/thaw cycle.
Gene Name ATAD2B ATPase family AAA domain containing 2B [ Homo sapiens (human) ]
Official Symbol ATAD2B
Synonyms ATAD2B; ATPase family AAA domain containing 2B; ATPase family AAA domain-containing protein 2B
Gene ID 54454
mRNA Refseq NM_017552
Protein Refseq NP_060022
MIM 615347
UniProt ID Q9ULI0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATAD2B Products

Required fields are marked with *

My Review for All ATAD2B Products

Required fields are marked with *

0
cart-icon
0
compare icon