Recombinant Active Human ATAD2B Protein (953 to 1080), C-6×His tagged
Cat.No. : | ATAD2B-12H |
Product Overview : | Recombinant Active Human ATAD2B Protein (953-1080) with C-6×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 953 to 1080 |
Description : | The protein encoded by this gene belongs to the AAA ATPase family. This family member includes an N-terminal bromodomain. It has been found to be localized to the nucleus, partly to replication sites, consistent with a chromatin-related function. Alternative splicing of this gene results in multiple transcript variants. |
Form : | Liquid |
Molecular Mass : | Predicted molecular weight: 42 kDa including tags |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKE |
Purity : | > 95% SDS-PAGE |
Applications : | Functional Studies, SDS-PAGE |
Storage Buffer : | pH: 8 Constituents: 0.48% Tris, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Shipping : | Shipped on Dry Ice. Store at -80 centigrade. Avoid freeze/thaw cycle. |
Gene Name | ATAD2B ATPase family AAA domain containing 2B [ Homo sapiens (human) ] |
Official Symbol | ATAD2B |
Synonyms | ATAD2B; ATPase family AAA domain containing 2B; ATPase family AAA domain-containing protein 2B |
Gene ID | 54454 |
mRNA Refseq | NM_017552 |
Protein Refseq | NP_060022 |
MIM | 615347 |
UniProt ID | Q9ULI0 |
◆ Recombinant Proteins | ||
ATAD2B-12H | Recombinant Active Human ATAD2B Protein (953 to 1080), C-6×His tagged | +Inquiry |
ATAD2B-54H | Recombinant Human ATAD2B protein, His-tagged | +Inquiry |
ATAD2B-53H | Recombinant Human ATAD2B protein, GST-tagged | +Inquiry |
ATAD2B-01H | Recombinant Human ATAD2B Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATAD2B Products
Required fields are marked with *
My Review for All ATAD2B Products
Required fields are marked with *