Recombinant Active Human CNTF Protein, His-tagged(C-ter)

Name: Recombinant Active Human CNTF Protein, His-tagged(C-ter)
SKU: CNTF-43H

Species :	Human
Source :	E.coli
Tag :	His
Description :	The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010]
Form :	Powder
Bio-activity :	Determined by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 0.15 μg/mL.
AA Sequence :	MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTQSYVKHQGLNKNINLDSADGMPVASTDQWSQLTQAQRLQQNLQAYRTFHVLLARLLQDQQVHFTPTQGDFHQAIHTLLLQVAAFAYQIQQLMILLQYKIPRNQADGMPINVGDGGLFQKKLWGLKVLQQLSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Endotoxin :	Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity :	> 98% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	PBS (pH 7.4)
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Name	CNTF ciliary neurotrophic factor [ Homo sapiens ]
Official Symbol	CNTF
Synonyms	CNTF; ciliary neurotrophic factor; HCNTF;
Gene ID	1270
mRNA Refseq	NM_000614
Protein Refseq	NP_000605
MIM	118945
UniProt ID	P26441