Recombinant Active Human CNTF Protein, His-tagged(C-ter)

Cat.No. : CNTF-43H
Product Overview : Recombinant Active Human CNTF Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 0.15 μg/mL.
AA Sequence : MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTQSYVKHQGLNKNINLDSADGMPVASTDQWSQLTQAQRLQQNLQAYRTFHVLLARLLQDQQVHFTPTQGDFHQAIHTLLLQVAAFAYQIQQLMILLQYKIPRNQADGMPINVGDGGLFQKKLWGLKVLQQLSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Endotoxin : Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name CNTF ciliary neurotrophic factor [ Homo sapiens ]
Official Symbol CNTF
Synonyms CNTF; ciliary neurotrophic factor; HCNTF;
Gene ID 1270
mRNA Refseq NM_000614
Protein Refseq NP_000605
MIM 118945
UniProt ID P26441

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTF Products

Required fields are marked with *

My Review for All CNTF Products

Required fields are marked with *

0
cart-icon
0
compare icon