Recombinant Active Human FGF1 Protein, His-tagged(C-ter)
| Cat.No. : | FGF1-72H |
| Product Overview : | Recombinant Active Human FGF1 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009] |
| Form : | Powder |
| Bio-activity : | Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 0.3 ng/mL. The specific activity of recombinant human FGF-1 is > 1 x 10^6 IU/mg. |
| AA Sequence : | MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
| Purity : | > 98% (by SDS-PAGE) |
| Applications : | SDS-PAGE |
| Notes : | For laboratory research only, not for drug, diagnostic or other use. |
| Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
| Storage Buffer : | PBS (pH 8.0) |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
| Gene Name | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
| Official Symbol | FGF1 |
| Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
| Gene ID | 2246 |
| mRNA Refseq | NM_000800 |
| Protein Refseq | NP_000791 |
| MIM | 131220 |
| UniProt ID | P05230 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *



