Recombinant Active Human FGF1 Protein, His-tagged(C-ter)

Name: Recombinant Active Human FGF1 Protein, His-tagged(C-ter)
SKU: FGF1-72H

Species :	Human
Source :	E.coli
Tag :	His
Description :	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]
Form :	Powder
Bio-activity :	Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 0.3 ng/mL. The specific activity of recombinant human FGF-1 is > 1 x 10^6 IU/mg.
AA Sequence :	MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin :	Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity :	> 98% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	PBS (pH 8.0)
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Name	FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ]
Official Symbol	FGF1
Synonyms	FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha;
Gene ID	2246
mRNA Refseq	NM_000800
Protein Refseq	NP_000791
MIM	131220
UniProt ID	P05230