Recombinant Active Human IL17B Protein, His-tagged(C-ter)

Cat.No. : IL17B-150H
Product Overview : Recombinant Active Human IL17B Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 49 ng/mL.
AA Sequence : MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name IL17B interleukin 17B [ Homo sapiens ]
Official Symbol IL17B
Synonyms IL17B; interleukin 17B; interleukin-17B; IL 17B; IL 20; MGC138900; MGC138901; neuronal interleukin 17 related factor; NIRF; ZCYTO7; interleukin 20; interleukin-20; cytokine Zcyto7; interleukin-17 beta; cytokine-like protein ZCYTO7; neuronal interleukin-17 related factor; neuronal interleukin-17-related factor; IL-20; IL-17B;
Gene ID 27190
mRNA Refseq NM_014443
Protein Refseq NP_055258
MIM 604627
UniProt ID Q9UHF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17B Products

Required fields are marked with *

My Review for All IL17B Products

Required fields are marked with *

0
cart-icon
0
compare icon