Recombinant Active Human IL17B Protein, His-tagged(C-ter)
Cat.No. : | IL17B-150H |
Product Overview : | Recombinant Active Human IL17B Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 49 ng/mL. |
AA Sequence : | MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL17B interleukin 17B [ Homo sapiens ] |
Official Symbol | IL17B |
Synonyms | IL17B; interleukin 17B; interleukin-17B; IL 17B; IL 20; MGC138900; MGC138901; neuronal interleukin 17 related factor; NIRF; ZCYTO7; interleukin 20; interleukin-20; cytokine Zcyto7; interleukin-17 beta; cytokine-like protein ZCYTO7; neuronal interleukin-17 related factor; neuronal interleukin-17-related factor; IL-20; IL-17B; |
Gene ID | 27190 |
mRNA Refseq | NM_014443 |
Protein Refseq | NP_055258 |
MIM | 604627 |
UniProt ID | Q9UHF5 |
◆ Recombinant Proteins | ||
Il17b-01M | Active Recombinant Mouse Il17b Protein, His-Tagged | +Inquiry |
Il17b-440M | Recombinant Mouse Il17b protein, Fc-tagged | +Inquiry |
Il17b-1821R | Recombinant Rat Il17b protein, His-tagged | +Inquiry |
IL17B-29741TH | Recombinant Human IL17B protein | +Inquiry |
IL17B-3516H | Recombinant Human IL17B Protein (Gln21-Phe180), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17B-5244HCL | Recombinant Human IL17B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17B Products
Required fields are marked with *
My Review for All IL17B Products
Required fields are marked with *
0
Inquiry Basket