Recombinant Active Human IL23A Protein, His-tagged(N-ter)
Cat.No. : | IL23A-179H |
Product Overview : | Recombinant Active Human IL23A Protein with His tag (N-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Measured by its ability to induce IL-17 secretion in mouse splenocytes. The ED50 for this effect is < 0.5 ng/mL |
AA Sequence : | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL23A interleukin 23, alpha subunit p19 [ Homo sapiens ] |
Official Symbol | IL23A |
Synonyms | IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL 23; IL 23A; IL23P19; interleukin six; G CSF related factor; P19; SGRF; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin 23 p19 subunit; interleukin-23 subunit p19; JKA3 induced upon T-cell activation; interleukin-six, G-CSF related factor; IL-23; IL-23A; MGC79388; |
Gene ID | 51561 |
mRNA Refseq | NM_016584 |
Protein Refseq | NP_057668 |
MIM | 605580 |
UniProt ID | Q9NPF7 |
◆ Recombinant Proteins | ||
Il23A-602HF | Recombinant Full Length Human Il23A Protein, GST-tagged | +Inquiry |
IL23A-966H | Active Recombinant Human IL23A Protein | +Inquiry |
IL23A-5832H | Recombinant Human IL23 Protein (Arg20-Pro189, Ile23-Ser328), C-His and C-Flag tagged | +Inquiry |
IL23A-4846H | Recombinant Human IL23A Protein (Arg20-Pro189), C-His tagged | +Inquiry |
Il23a-1927M | Recombinant Mouse Il23a Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?
02/01/2023
Please inquiry our product manager with specific product.
Ask a Question for All IL23A Products
Required fields are marked with *
My Review for All IL23A Products
Required fields are marked with *
0
Inquiry Basket