Recombinant Active Human IL32 Protein, His-tagged(C-ter)
Cat.No. : | IL32-190H |
Product Overview : | Recombinant Active Human IL32 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED50 for this effect is < 10 μg/mL. |
AA Sequence : | MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL32 interleukin 32 [ Homo sapiens ] |
Official Symbol | IL32 |
Synonyms | IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma; |
Gene ID | 9235 |
mRNA Refseq | NM_001012631 |
Protein Refseq | NP_001012649 |
MIM | 606001 |
UniProt ID | P24001 |
◆ Recombinant Proteins | ||
IL32-173H | Recombinant Human IL-32α Protein | +Inquiry |
IL32-156H | Recombinant Human IL32 protein(Met1-Lys131), His-tagged | +Inquiry |
IL32-5300H | Recombinant Human IL32 Protein (Met1-Lys234), C-His tagged | +Inquiry |
IL32-108H | Recombinant Human Lnterleukin 32, His-tagged | +Inquiry |
IL32-20H | Recombinant Human IL32 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL32-2743HCL | Recombinant Human IL32 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL32 Products
Required fields are marked with *
My Review for All IL32 Products
Required fields are marked with *
0
Inquiry Basket