Recombinant Active Human LGALS7 Protein, His-tagged(N-ter)
| Cat.No. : | LGALS7-230H |
| Product Overview : | Recombinant Active Human LGALS7 Protein with His tag (N-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008] |
| Form : | Powder |
| Bio-activity : | Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 2 μg/mL. |
| AA Sequence : | SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
| Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
| Purity : | > 98% (by SDS-PAGE) |
| Applications : | SDS-PAGE |
| Notes : | For laboratory research only, not for drug, diagnostic or other use. |
| Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
| Storage Buffer : | PBS (pH 7.4) |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
| Gene Name | LGALS7 lectin, galactoside-binding, soluble, 7 [ Homo sapiens ] |
| Official Symbol | LGALS7 |
| Synonyms | LGALS7; lectin, galactoside-binding, soluble, 7; galectin-7; GAL7; galectin 7; LGALS7A; PIG1; TP53I1; |
| Gene ID | 3963 |
| mRNA Refseq | NM_002307 |
| Protein Refseq | NP_002298 |
| MIM | 600615 |
| UniProt ID | P47929 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS7 Products
Required fields are marked with *
My Review for All LGALS7 Products
Required fields are marked with *
Recently Viewed
