Recombinant Active Human NRTN Protein, His-tagged(C-ter)

Species :	Human
Source :	E.coli
Tag :	His
Description :	Neurturin is a member of the TGF-beta subfamily, TRN. This gene signals through RET and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease. [provided by RefSeq, Jul 2008]
Form :	Powder
Bio-activity :	Determined by its ability to induce proliferation in SH-SY5Y cells. The ED50 for this effect is < 50 ng/mL.
AA Sequence :	MARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
Endotoxin :	Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity :	> 98% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	PBS (pH 7.4)
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.