Recombinant Active Human NRTN Protein, His-tagged(C-ter)

Cat.No. : NRTN-259H
Product Overview : Recombinant Active Human NRTN Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Neurturin is a member of the TGF-beta subfamily, TRN. This gene signals through RET and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in SH-SY5Y cells. The ED50 for this effect is < 50 ng/mL.
AA Sequence : MARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name NRTN neurturin [ Homo sapiens ]
Official Symbol NRTN
Synonyms NRTN; neurturin; NTN;
Gene ID 4902
mRNA Refseq NM_004558
Protein Refseq NP_004549
MIM 602018
UniProt ID Q99748

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRTN Products

Required fields are marked with *

My Review for All NRTN Products

Required fields are marked with *

0
cart-icon