Recombinant Active Mouse IGF1 Protein, His-tagged(C-ter)
Cat.No. : | Igf1-128M |
Product Overview : | Recombinant Active Mouse IGF1 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is < 2 ng/mL. The specific activity of recombinant mouse IGF-I is > 5 x 10^5 IU/mg. |
AA Sequence : | MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Igf1 insulin-like growth factor 1 [ Mus musculus ] |
Official Symbol | Igf1 |
Synonyms | IGF1; insulin-like growth factor 1; insulin-like growth factor I; somatomedin; Igf-1; Igf-I; C730016P09Rik; |
Gene ID | 16000 |
mRNA Refseq | NM_001111274 |
Protein Refseq | NP_001104744 |
◆ Recombinant Proteins | ||
IGF1-808C | Recombinant Cattle IGF1 protein, His & GST-tagged | +Inquiry |
IGF1-606H | Recombinant Human Insulin-Like Growth Factor 1 (somatomedin C) | +Inquiry |
IGF1-109I | Active Recombinant Human IGF1 Protein (70 aa) | +Inquiry |
IGF1-437M | Recombinant Mouse IGF1 protein(Gly49-Ala118) | +Inquiry |
IGF1-986D | Recombinant Dog IGF1 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
0
Inquiry Basket