| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015] |
| Form : |
Powder |
| Bio-activity : |
Determined by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is < 2 ng/mL. The specific activity of recombinant mouse IGF-I is > 5 x 10^5 IU/mg. |
| AA Sequence : |
MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA |
| Endotoxin : |
Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
| Purity : |
> 98% (by SDS-PAGE) |
| Applications : |
SDS-PAGE |
| Notes : |
For laboratory research only, not for drug, diagnostic or other use. |
| Storage : |
Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
| Storage Buffer : |
PBS (pH 8.0) |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |