Recombinant Active Mouse IL36A Protein, His-tagged(C-ter)
| Cat.No. : | Il36a-196M |
| Product Overview : | Recombinant Active Mouse IL36A Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | Enables cytokine activity. Acts upstream of or within positive regulation of interleukin-6 production. Located in extracellular space. Orthologous to human IL36A (interleukin 36 alpha). |
| Form : | Powder |
| Bio-activity : | Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 10^5 IU/mg. |
| AA Sequence : | MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH |
| Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
| Purity : | > 98% (by SDS-PAGE) |
| Applications : | SDS-PAGE |
| Notes : | For laboratory research only, not for drug, diagnostic or other use. |
| Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
| Storage Buffer : | PBS (pH 7.4) |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
| Gene Name | Il36a interleukin 36A [ Mus musculus (house mouse) ] |
| Official Symbol | Il36a |
| Synonyms | Il36a; interleukin 36A; Fil1; If36a; Il1f6; Il1f9; IL-1H1; IL1RP2; |
| Gene ID | 54448 |
| mRNA Refseq | NM_019450 |
| Protein Refseq | NP_062323 |
| UniProt ID | Q9JLA2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36A Products
Required fields are marked with *
My Review for All IL36A Products
Required fields are marked with *



