Recombinant Active Mouse IL36G Protein, His-tagged(C-ter)
Cat.No. : | Il36g-199M |
Product Overview : | Recombinant Active Mouse IL36G Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 10^4 IU/mg. |
AA Sequence : | MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il36g interleukin 36G [ Mus musculus (house mouse) ] |
Official Symbol | Il36g |
Synonyms | Il36g; interleukin 36G; If36g; Il1f9; IL-36gamma; |
Gene ID | 215257 |
mRNA Refseq | NM_153511 |
Protein Refseq | NP_705731 |
UniProt ID | Q3U0P4 |
◆ Recombinant Proteins | ||
Il36g-1309M | Recombinant Mouse Il36g protein, His-tagged | +Inquiry |
IL36G-2584H | Active Recombinant Human IL36G protein | +Inquiry |
IL1F9-160H | Recombinant Human IL1F9 protein(Ser18-Asp169) | +Inquiry |
IL36G-151H | Recombinant Human IL36G Protein, His-tagged | +Inquiry |
IL36G-511H | Recombinant Human IL36G protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36G-5235HCL | Recombinant Human IL1F9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36G Products
Required fields are marked with *
My Review for All IL36G Products
Required fields are marked with *
0
Inquiry Basket