Recombinant Human IL36G Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IL36G-5107H |
Product Overview : | IL1F9 MS Standard C13 and N15-labeled recombinant protein (NP_062564) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. |
Molecular Mass : | 18.7 kDa |
AA Sequence : | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNINDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IL36G interleukin 36 gamma [ Homo sapiens (human) ] |
Official Symbol | IL36G |
Synonyms | IL36G; interleukin 36, gamma; IL1F9, interleukin 1 family, member 9; interleukin-36 gamma; IL 1F9; IL 1H1; IL 1RP2; IL1E; IL1H1; interleukin 1 related protein 2; interleukin 1 epsilon; interleukin 1 homolog 1; IL-1 epsilon; IL-1-epsilon; IL-1(EPSILON); interleukin-1 epsilon; IL-1 related protein 2; IL-1-related protein 2; interleukin-1 homolog 1; interleukin-1 family member 9; interleukin 1 family, member 9; interleukin 1-related protein 2; IL1F9; IL-1F9; IL-1H1; IL1RP2; IL-1RP2; |
Gene ID | 56300 |
mRNA Refseq | NM_019618 |
Protein Refseq | NP_062564 |
MIM | 605542 |
UniProt ID | Q9NZH8 |
◆ Recombinant Proteins | ||
IL1F9-160H | Recombinant Human IL1F9 protein(Ser18-Asp169) | +Inquiry |
IL36G-754H | Recombinant Human IL36G protein, His-tagged | +Inquiry |
IL36G-2584H | Active Recombinant Human IL36G protein | +Inquiry |
IL36G;-2316H | Recombinant Human IL36G; Protein, His-tagged | +Inquiry |
IL36G-15880H | Recombinant Human IL36B, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36G-5235HCL | Recombinant Human IL1F9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36G Products
Required fields are marked with *
My Review for All IL36G Products
Required fields are marked with *