Recombinant Active Pig IL15 Protein, His-tagged(N-ter)

Cat.No. : IL15-147P
Product Overview : Recombinant Active Pig IL15 Protein with His tag (N-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 5.5 ng/mL.
AA Sequence : TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS
Endotoxin : Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name IL15 interleukin 15 [ Sus scrofa ]
Official Symbol IL15
Synonyms IL15; interleukin 15; interleukin-15; IL-15;
Gene ID 397683
mRNA Refseq NM_214390
Protein Refseq NP_999555

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL15 Products

Required fields are marked with *

My Review for All IL15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon