Recombinant Active Pig IL1B Protein, His-tagged(C-ter)
Cat.No. : | IL1B-163P |
Product Overview : | Recombinant Active Pig IL1B Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is < 3 ng/mL. |
AA Sequence : | MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL1B interleukin 1, beta [ Sus scrofa ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL-1 beta; prointerleukin-1 beta; |
Gene ID | 397122 |
mRNA Refseq | NM_214055 |
Protein Refseq | NP_999220 |
◆ Recombinant Proteins | ||
Il1b-5314M | Recombinant Mouse Il1b protein, His-tagged | +Inquiry |
IL1B-29H | Active Recombinant Human IL1B Protein, Animal Free | +Inquiry |
IL1B-059H | Active Recombinant Human IL1B Protein | +Inquiry |
IL1B-250I | Active Recombinant Human IL1B Protein | +Inquiry |
IL1B-3097H | Recombinant Human IL1B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
0
Inquiry Basket