Recombinant Active Pig IL4 Protein, His-tagged(C-ter)

Name: Recombinant Active Pig IL4 Protein, His-tagged(C-ter)
SKU: IL4-205P

Species :	Pig
Source :	E.coli
Tag :	His
Description :	The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Form :	Powder
Bio-activity :	Determined by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 0.6 ng/mL.
AA Sequence :	MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC
Endotoxin :	Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity :	> 98% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	PBS (pH 7.4)
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Name	IL4 interleukin 4 [ Sus scrofa ]
Official Symbol	IL4
Synonyms	IL4; interleukin 4; interleukin-4; IL-4; BSF-1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1;
Gene ID	397225
mRNA Refseq	NM_214123
Protein Refseq	NP_999288