Recombinant Active Pig IL4 Protein, His-tagged(C-ter)
| Cat.No. : | IL4-205P |
| Product Overview : | Recombinant Active Pig IL4 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His |
| Description : | The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
| Form : | Powder |
| Bio-activity : | Determined by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 0.6 ng/mL. |
| AA Sequence : | MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC |
| Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
| Purity : | > 98% (by SDS-PAGE) |
| Applications : | SDS-PAGE |
| Notes : | For laboratory research only, not for drug, diagnostic or other use. |
| Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
| Storage Buffer : | PBS (pH 7.4) |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
| Gene Name | IL4 interleukin 4 [ Sus scrofa ] |
| Official Symbol | IL4 |
| Synonyms | IL4; interleukin 4; interleukin-4; IL-4; BSF-1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; |
| Gene ID | 397225 |
| mRNA Refseq | NM_214123 |
| Protein Refseq | NP_999288 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *



