Recombinant Aedes Aegypti D7 Protein (18-321 aa), His-tagged

Cat.No. : D7-2079A
Product Overview : Recombinant Aedes Aegypti (Yellowfever mosquito) (Culex aegypti) D7 Protein (18-321 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Allergen. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Aedes Aegypti
Source : Yeast
Tag : His
Protein Length : 18-321 aa
Description : Thought to be involved in blood-feeding.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 37.1 kDa
AA Sequence : STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms D7; Alternative name(s): Protein D7 Allergen: Aed a 2;
UniProt ID P18153

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All D7 Products

Required fields are marked with *

My Review for All D7 Products

Required fields are marked with *

0
cart-icon
0
compare icon