Active Recombinant Aeromonas AMPX Protein
Cat.No. : | AMPX-1120A |
Product Overview : | Recombinant Aeromonas AMPX Protein witout tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aeromonas |
Source : | E.coli |
Description : | Release of an N-terminal amino acid, preferentially leucine, but not glutamic or aspartic acids. |
Bio-activity : | Sequentially cleaves N-terminal amino acids except E, D, and X-P. |
Molecular Mass : | 31.4 kDa |
AA Sequence : | MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG |
Purity : | ≥98% by SDS-PAGE gel and HPLC analyses. |
◆ Recombinant Proteins | ||
AMPX-1120A | Active Recombinant Aeromonas AMPX Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMPX Products
Required fields are marked with *
My Review for All AMPX Products
Required fields are marked with *
0
Inquiry Basket