| Species : |
Aeromonas |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
291 |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 150 mM NaCl, 5μM ZnSO4, pH 8.0. |
| Bio-activity : |
Sequentially cleaves N-terminal amino acids except E, D, and X-P. |
| Molecular Mass : |
Approximately 31.4 kDa, a single non-glycosylated polypeptide chain containing 291 amino acids. |
| AA Sequence : |
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG |
| Endotoxin : |
Less than 0.1 EU/µg of rAeromonas Aminopeptidase as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
