Recombinant Aeromonas Hydrophila FKPA Protein (21-268 aa), His-SUMO-tagged
| Cat.No. : | FKPA-982A |
| Product Overview : | Recombinant Aeromonas Hydrophila FKPA Protein (21-268 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Aeromonas Hydrophila |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-268 aa |
| Description : | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FkpA probably acts in the folding of extraCytoplasmic domain proteins. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| UniProt ID | O08437 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKPA Products
Required fields are marked with *
My Review for All FKPA Products
Required fields are marked with *
