Recombinant AKV murine leukemia virus env protein, GST&His-tagged
Cat.No. : | env-564A |
Product Overview : | Recombinant AKV murine leukemia virus env protein(P03386)(32-470aa), fused with N-terminal GST tag and C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | AKV murine leukemia virus |
Source : | Insect cells |
Tag : | GST&His |
Protein Length : | 32-470aa |
Tag : | N-GST&C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 75.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VTLGNSPHQVFNLTWEVTNGDRETVWAITGNHPLWTWWPDLTPDLCMLALHGPSYWGLEYRAPFSPPPGPPCCSGSSDSTPGCSRDCEEPLTSYTPRCNTAWNRLKLSKVTHAHNGGFYVCPGPHRPRWARSCGGPESFYCASWGCETTGRASWKPSSSWDYITVSNNLTSDQATPVCKGNEWCNSLTIRFTSFGKQATSWVTGHWWGLRLYVSGHDPGLIFGIRLKITDSGPRVPIGPNPVLSDRRPPSRPRPTRSPPPSNSTPTETPLTLPEPPPAGVENRLLNLVKGAYQALNLTSPDKTQECWLCLVSGPPYYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCIGAVPKTHQVLCNTTQKTSDGSYYLAAPTGTTWACSTGLTPCISTTILDLTTDYCVLVELWPRVTYHSPSYVYHQFERRAKYKR |
◆ Recombinant Proteins | ||
env-163H | Recombinant HIV env protein | +Inquiry |
env-166H | Recombinant HIV (IIIB) env protein, β-gal-tagged | +Inquiry |
env-764H | Recombinant HIV1 env Protein, His-tagged | +Inquiry |
Env-77H | Recombinant HTLV-1 Env protein, His-SUMO-tagged | +Inquiry |
env-014F | Recombinant FIV gp40 Envelope protein, His&TrxA tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All env Products
Required fields are marked with *
My Review for All env Products
Required fields are marked with *