Recombinant Alternaria Alternata HSP70 Protein (1-152 aa), His-tagged
Cat.No. : | HSP70-1932A |
Product Overview : | Recombinant Alternaria Alternata (Alternaria rot fungus) (Torula alternata) HSP70 Protein (1-152 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alternaria Alternata |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-152 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.2 kDa |
AA Sequence : | KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | HSP70; Allergen: Alt a 3; |
UniProt ID | P78983 |
◆ Recombinant Proteins | ||
HSP70-8971Z | Recombinant Zebrafish HSP70 | +Inquiry |
HSP70-28C | Recombinant Chlamydia Trachomatis HSP70 protein | +Inquiry |
HSP70-1896A | Recombinant Alternaria Alternata HSP70 Protein (1-152 aa), His-tagged | +Inquiry |
HSP70-1932A | Recombinant Alternaria Alternata HSP70 Protein (1-152 aa), His-tagged | +Inquiry |
HSP70-3422T | Recombinant Toxoplasma gondii (strain ATCC 50611 / Me49) HSP70 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSP70 Products
Required fields are marked with *
My Review for All HSP70 Products
Required fields are marked with *
0
Inquiry Basket