Recombinant American bullfrog SAX Protein(484-844aa), His-tagged
Cat.No. : | SAX-4326A |
Product Overview : | Recombinant American bullfrog SAX Protein(484-844aa)(P31226), fused with C-terminal His tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | American bullfrog |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 484-844aa |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 41.7 kDa |
AA Sequence : | AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
◆ Recombinant Proteins | ||
SAX-4326A | Recombinant American bullfrog SAX Protein(484-844aa), His-tagged | +Inquiry |
SAX-532A | Recombinant American bullfrog SAX Protein(484-844aa), His-tagged | +Inquiry |
SAX-5089A | Recombinant American bullfrog SAX protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAX Products
Required fields are marked with *
My Review for All SAX Products
Required fields are marked with *