Recombinant Apple Major allergen Mal d 1 Protein, His-SUMO-tagged
| Cat.No. : | MALD1-1273A |
| Product Overview : | Recombinant Apple Major allergen Mal d 1 Protein (2-159aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Apple |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-159 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 33.5 kDa |
| AA Sequence : | GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHR IDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAH GLFKLIESYLKDHPDAYN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | LOC103425638 major allergen Mal d 1 [ Malus domestica (apple) ] |
| Official Symbol | major allergen Mal d 1 |
| Synonyms | major allergen Mal d 1; Allergen Mal d I; Mal d 1; Allergen; Mal d 1-like; Mal d 1.01; Mal d 1.02; Mal d 1.0201; Mal d 1.0209; PR-10 protein; allergen Mal d 1.02; major allergen Mal d 1.02; major allergen d 1; putative Mal d 1.02 isoallergen |
| Gene ID | 103425638 |
| mRNA Refseq | NM_001294363.1 |
| Protein Refseq | NP_001281292.1 |
| UniProt ID | P43211 |
| ◆ Recombinant Proteins | ||
| MALD1-1273A | Recombinant Apple Major allergen Mal d 1 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Major allergen Mal d 1 Products
Required fields are marked with *
My Review for All Major allergen Mal d 1 Products
Required fields are marked with *
Recently Viewed
