Recombinant Apple Major allergen Mal d 1 Protein, His-SUMO-tagged

Cat.No. : MALD1-1273A
Product Overview : Recombinant Apple Major allergen Mal d 1 Protein (2-159aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Apple
Source : E.coli
Tag : His&SUMO
Protein Length : 2-159 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 33.5 kDa
AA Sequence : GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHR
IDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAH
GLFKLIESYLKDHPDAYN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name LOC103425638 major allergen Mal d 1 [ Malus domestica (apple) ]
Official Symbol major allergen Mal d 1
Synonyms major allergen Mal d 1; Allergen Mal d I; Mal d 1; Allergen; Mal d 1-like; Mal d 1.01; Mal d 1.02; Mal d 1.0201; Mal d 1.0209; PR-10 protein; allergen Mal d 1.02; major allergen Mal d 1.02; major allergen d 1; putative Mal d 1.02 isoallergen
Gene ID 103425638
mRNA Refseq NM_001294363.1
Protein Refseq NP_001281292.1
UniProt ID P43211

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Major allergen Mal d 1 Products

Required fields are marked with *

My Review for All Major allergen Mal d 1 Products

Required fields are marked with *

0
cart-icon
0
compare icon