Recombinant Arabidopsis thaliana AT1G78040 Protein, His-tagged
| Cat.No. : | AT1G78040-07A |
| Product Overview : | Recombinant Arabidopsis thaliana AT1G78040 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Arabidopsis thaliana |
| Source : | E.coli |
| Tag : | His |
| Description : | Pollen Ole e 1 allergen and extensin family protein |
| Form : | PBS (pH 7.4) |
| Molecular Mass : | 14.79 kDa |
| AA Sequence : | MSWQAYVDDHLMCEIDGNHLSAAAIIGHDGSVWAQSAAFPQLKPEEVTGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGAGGVTIKKTSQALIIGVYDEPMTPGQCNMIVERLGDYLIDQGLHHHHHH |
| Purity : | > 90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.59 mg/ml |
| Gene Name | AT1G78040 Pollen Ole e 1 allergen and extensin family protein [ Arabidopsis thaliana (thale cress) ] |
| Official Symbol | AT1G78040 |
| Synonyms | F28K19.26; F28K19_26 |
| Gene ID | 844139 |
| mRNA Refseq | NM_106453 |
| Protein Refseq | NP_177927 |
| UniProt ID | Q8LD45 |
| ◆ Recombinant Proteins | ||
| AT1G78040-07A | Recombinant Arabidopsis thaliana AT1G78040 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AT1G78040 Products
Required fields are marked with *
My Review for All AT1G78040 Products
Required fields are marked with *
Recently Viewed
