Recombinant Arabidopsis Thaliana AXR3 Protein (1-229 aa), His-Myc-tagged

• Cat.No.: AXR3-2670A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) AXR3 Protein (1-229 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Arabidopsis Thaliana
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-229 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 32.3 kDa
• AA Sequence: MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: AXR3 AUX/IAA transcriptional regulator family protein [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: AXR3
• Synonyms: AXR3; AtIAA17; AUXIN RESISTANT 3; F19P19.31; F19P19_31; IAA17; indole-3-acetic acid inducible 17
• Gene ID: 839568
• mRNA Refseq: NM_100306
• Protein Refseq: NP_171921
• UniProt ID: P93830