Recombinant Arabidopsis Thaliana BAS1 Protein (66-266 aa), His-tagged

• Cat.No.: BAS1-2347A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) BAS1 Protein (66-266 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Arabidopsis Thaliana
• Source: Yeast
• Tag: His
• Protein Length: 66-266 aa
• Description: May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.4 kDa
• AA Sequence: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: BAS1 Cytochrome P450 superfamily protein [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: BAS1
• Synonyms: BAS1
• Gene ID: 817212
• UniProt ID: Q96291