Recombinant Arabidopsis Thaliana CM1 Protein (3-247 aa), His-tagged

• Cat.No.: CM1-1258A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) CM1 Protein (3-247 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.

Specification

• Species: Arabidopsis Thaliana
• Source: E.coli
• Tag: His
• Protein Length: 3-247 aa
• Description: May play a role in chloroplast biogenesis.Curated.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.1 kDa
• AA Sequence: ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CM1 chorismate mutase 1 [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: CM1
• Synonyms: ARABIDOPSIS THALIANA CHORISMATE MUTASE 1; ATCM1; chorismate mutase 1
• Gene ID: 822573
• mRNA Refseq: NM_113844
• Protein Refseq: NP_566846
• UniProt ID: P42738