Recombinant Arabidopsis Thaliana HD2B Protein (1-306 aa), His-tagged

Cat.No. : HD2B-2349A
Product Overview : Recombinant Arabidopsis Thaliana (Mouse-ear cress) HD2B Protein (1-306 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Arabidopsis Thaliana
Source : Yeast
Tag : His
Protein Length : 1-306 aa
Description : Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.3 kDa
AA Sequence : MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name HD2B histone deacetylase 2B [ Arabidopsis thaliana (thale cress) ]
Official Symbol HD2B
Synonyms HDT2; ATHD2; ATHD2B; HD2; HDA4; HDT02; HDT2; histone deacetylase 2B; MDJ22.7; MDJ22_7;
Gene ID 832328
mRNA Refseq NM_180725
Protein Refseq NP_851056
UniProt ID Q56WH4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HD2B Products

Required fields are marked with *

My Review for All HD2B Products

Required fields are marked with *

0
cart-icon
0
compare icon