Recombinant Arabidopsis Thaliana NDPK1 Protein (1-149 aa), His-Myc-tagged

• Cat.No.: NDPK1-2348A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) NDPK1 Protein (1-149 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Arabidopsis Thaliana
• Source: Yeast
• Tag: His&Myc
• Protein Length: 1-149 aa
• Description: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.5 kDa
• AA Sequence: MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: NDPK1 nucleoside diphosphate kinase [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: NDPK1
• Synonyms: NDK1
• Gene ID: 826515
• mRNA Refseq: NM_117000
• Protein Refseq: NP_567346
• UniProt ID: P39207