Recombinant Aspergillus fumigatus mitF protein, His-SUMO & Myc-tagged
Cat.No. : | mitF-3722A |
Product Overview : | Recombinant Aspergillus fumigatus mitF protein(P67875)(28-176aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus fumigatus |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 28-176aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.4 kDa |
AA Sequence : | ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
MITF-6586C | Recombinant Chicken MITF | +Inquiry |
mitF-3722A | Recombinant Aspergillus fumigatus mitF protein, His-SUMO & Myc-tagged | +Inquiry |
MITF-2446H | Recombinant Human MITF Protein, His-tagged | +Inquiry |
MITF-30239TH | Recombinant Human MITF, GST-tagged | +Inquiry |
MITF-2776R | Recombinant Rhesus monkey MITF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MITF-4306HCL | Recombinant Human MITF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mitF Products
Required fields are marked with *
My Review for All mitF Products
Required fields are marked with *