Recombinant Aspergillus Niger PHYA Protein (24-467 aa), His-tagged
Cat.No. : | PHYA-1589A |
Product Overview : | Recombinant Aspergillus Niger PHYA Protein (24-467 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
Availability | June 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus Niger |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-467 aa |
Description : | Catalyzes the hydrolysis of inorganic orthophosphate from phytate. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 50.8 kDa |
AA Sequence : | ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | phyA; 3 phytase A Myo-inositol hexakisphosphate phosphohydrolase A Myo-inositol-hexaphosphate 3-phosphohydrolase A; |
UniProt ID | P34752 |
◆ Recombinant Proteins | ||
PHYA-1589A | Recombinant Aspergillus Niger PHYA Protein (24-467 aa), His-tagged | +Inquiry |
PHYA-910A | Recombinant Aspergillus Niger PHYA Protein (24-467 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHYA Products
Required fields are marked with *
My Review for All PHYA Products
Required fields are marked with *
0
Inquiry Basket