Recombinant Avian leukosis virus RSA gag protein, GST-tagged
Cat.No. : | gag-6421A |
Product Overview : | Recombinant Avian leukosis virus RSA gag protein(P0C776)(240-476aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Avian leukosis virus RSA |
Source : | E.coli |
Tag : | GST |
Protein Length : | 240-476aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAPLTDQGIA |
◆ Recombinant Proteins | ||
gag-6421A | Recombinant Avian leukosis virus RSA gag protein, GST-tagged | +Inquiry |
gag-725V | Recombinant HIV gag Protein, His-tagged | +Inquiry |
gag-6728M | Recombinant Mouse gag Protein (Met1-Asp536), N-His tagged | +Inquiry |
gag-186H | Recombinant HIV gag protein | +Inquiry |
gag-356V | Recombinant HIV gag Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All gag Products
Required fields are marked with *
My Review for All gag Products
Required fields are marked with *