Recombinant B. macerans Cyclomaltodextrin glucanotransferase Protein, His-tagged
| Cat.No. : | CGTase-1177B |
| Product Overview : | Recombinant Bacillus macerans Cyclomaltodextrin glucanotransferase Protein (608-713aa) was expressed in yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | B.macerans |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 608-713 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 13.4 kDa |
| AA Sequence : | VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQF KFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Cyclomaltodextrin glucanotransferase |
| Official Symbol | Cyclomaltodextrin glucanotransferase |
| Synonyms | Cyclomaltodextrin glucanotransferase; EC= 2.4.1.19; CGTase; Cyclodextrin-glycosyltransferase; glucanotransferase; EC 2.4.1.19 |
| UniProt ID | P31835 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cyclomaltodextrin glucanotransferase Products
Required fields are marked with *
My Review for All Cyclomaltodextrin glucanotransferase Products
Required fields are marked with *
