Recombinant B. pertussis prn Protein, His-SUMO-tagged

• Cat.No.: prn-1340B
• Product Overview: Recombinant B. pertussis prn Protein (632-910aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: B.pertussis
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 632-910 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 45.8 kDa
• AA Sequence: ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: prn pertactin autotransporter [ Bordetella pertussis Tohama I ]
• Official Symbol: prn
• Synonyms: Pertactin autotransporter; P.93; Outer membrane protein P.69; Pertactin translocator; prn
• Gene ID: 2664290
• Protein Refseq: NP_879839.1
• UniProt ID: P14283