Recombinant B. pertussis prn Protein, His-SUMO-tagged

Cat.No. : Reg1-1349M
Product Overview : Recombinant B. pertussis prn Protein (632-919aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : B.pertussis
Source : E.coli
Tag : His&SUMO
Protein Length : 632-919 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 32.2 kDa
AA Sequence : QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESG
TTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVC
KFKG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Reg1 regenerating islet-derived 1 [ Mus musculus (house mouse) ]
Official Symbol Reg1
Synonyms Reg1; PSP; PTP; REG 1; islet of Langerhans regenerating protein 1; pancreatic stone protein 1; pancreatic thread protein 1; regenerating islet-derived, mouse homolog 1; regenerating protein 1; lithostathine-1
Gene ID 19692
mRNA Refseq NM_009042.1
Protein Refseq NP_033068.1
UniProt ID P43137

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Reg1 Products

Required fields are marked with *

My Review for All Reg1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon