Recombinant B. pertussis prn Protein, His-SUMO-tagged
Cat.No. : | Reg1-1349M |
Product Overview : | Recombinant B. pertussis prn Protein (632-919aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | B.pertussis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 632-919 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESG TTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVC KFKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Reg1 regenerating islet-derived 1 [ Mus musculus (house mouse) ] |
Official Symbol | Reg1 |
Synonyms | Reg1; PSP; PTP; REG 1; islet of Langerhans regenerating protein 1; pancreatic stone protein 1; pancreatic thread protein 1; regenerating islet-derived, mouse homolog 1; regenerating protein 1; lithostathine-1 |
Gene ID | 19692 |
mRNA Refseq | NM_009042.1 |
Protein Refseq | NP_033068.1 |
UniProt ID | P43137 |
◆ Recombinant Proteins | ||
Reg1-1349M | Recombinant B. pertussis prn Protein, His-SUMO-tagged | +Inquiry |
Reg1-4015M | Recombinant Mouse Reg1 protein, His-SUMO-tagged | +Inquiry |
Reg1-1757M | Recombinant Mouse Reg1 protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Reg1 Products
Required fields are marked with *
My Review for All Reg1 Products
Required fields are marked with *