Recombinant B. subtilis pbpD Protein, His-SUMO-tagged
Cat.No. : | pbpD-1322B |
Product Overview : | Recombinant Bacillus subtilis (strain 168) pbpD Protein (213-450aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | B.subtilis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 213-450 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 43.0 kDa |
AA Sequence : | PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQ LVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGA AVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYC PQNYNNRTYGTVTLDTAFKNSYNTPAIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | pbpD penicillin-binding protein 4 [ Bacillus subtilis subsp. subtilis str. 168 ] |
Official Symbol | pbpD |
Synonyms | pbpD; penicillin-binding protein 4 |
Gene ID | 938851 |
Protein Refseq | NP_391027.2 |
UniProt ID | P40750 |
◆ Recombinant Proteins | ||
pbpD-1322B | Recombinant B. subtilis pbpD Protein, His-SUMO-tagged | +Inquiry |
PBPD-1249B | Recombinant Bacillus subtilis PBPD protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All pbpD Products
Required fields are marked with *
My Review for All pbpD Products
Required fields are marked with *
0
Inquiry Basket