Recombinant B. subtilis pbpE Protein, His-SUMO-tagged

Cat.No. : pbpE-1323B
Product Overview : Recombinant B. subtilis pbpE Protein (1-451aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : B.subtilis
Source : E.coli
Tag : His&SUMO
Protein Length : 1-451 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 67.4 kDa
AA Sequence : MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name pbpE penicillin-binding protein 4 [ Bacillus subtilis subsp. subtilis str. 168 ]
Official Symbol pbpE
Synonyms penicillin-binding protein 4;
Gene ID 938615
Protein Refseq NP_391324.1
UniProt ID P32959

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All pbpE Products

Required fields are marked with *

My Review for All pbpE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon