Recombinant Bacillus Anthracis SSB Protein (1-172 aa), His-SUMO-tagged
Cat.No. : | SSB-1054B |
Product Overview : | Recombinant Bacillus Anthracis SSB Protein (1-172 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Anthracis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-172 aa |
Description : | Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit th to their sites of action during DNA metabolism. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 34.7 kDa |
AA Sequence : | MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | Q81JI3 |
◆ Recombinant Proteins | ||
ssb-30M | Recombinant Moraxella catarrhalis ssb Protein | +Inquiry |
SSB-150H | Recombinant Human SSB | +Inquiry |
SSB-721C | Recombinant Cynomolgus Monkey SSB Protein, His (Fc)-Avi-tagged | +Inquiry |
SSB-1240H | Recombinant Human SSB Protein, His-tagged | +Inquiry |
SSB-16022M | Recombinant Mouse SSB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSB-1466HCL | Recombinant Human SSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSB Products
Required fields are marked with *
My Review for All SSB Products
Required fields are marked with *
0
Inquiry Basket