Recombinant Bacillus Halodurans BH0637 Protein (1-328 aa), His-SUMO-Myc-tagged
Cat.No. : | BH0637-2327B |
Product Overview : | Recombinant Bacillus Halodurans (strain ATCC BAA-125/DSM 18197/FERM 7344/JCM 9153/C-125) BH0637 Protein (1-328 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Halodurans |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-328 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | BH0637; |
UniProt ID | Q9KF49 |
◆ Recombinant Proteins | ||
BH0637-2327B | Recombinant Bacillus Halodurans BH0637 Protein (1-328 aa), His-SUMO-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BH0637 Products
Required fields are marked with *
My Review for All BH0637 Products
Required fields are marked with *
0
Inquiry Basket