Recombinant Bacillus Halodurans BH0637 Protein (1-328 aa), His-SUMO-Myc-tagged

Cat.No. : BH0637-2327B
Product Overview : Recombinant Bacillus Halodurans (strain ATCC BAA-125/DSM 18197/FERM 7344/JCM 9153/C-125) BH0637 Protein (1-328 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bacillus Halodurans
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-328 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 57.7 kDa
AA Sequence : MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms BH0637;
UniProt ID Q9KF49

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BH0637 Products

Required fields are marked with *

My Review for All BH0637 Products

Required fields are marked with *

0
cart-icon
0
compare icon