Recombinant Bacillus Licheniformis APR Protein (106-379 aa), His-SUMO-tagged
Cat.No. : | APR-2205B |
Product Overview : | Recombinant Bacillus Licheniformis APR Protein (106-379 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Licheniformis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 106-379 aa |
Description : | Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 45.8 kDa |
AA Sequence : | AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | apr; |
UniProt ID | P00780 |
◆ Recombinant Proteins | ||
APR-2205B | Recombinant Bacillus Licheniformis APR Protein (106-379 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APR Products
Required fields are marked with *
My Review for All APR Products
Required fields are marked with *
0
Inquiry Basket