Recombinant Bacillus Pumilus ZAPA Protein (1-85 aa), His-SUMO-tagged
Cat.No. : | ZAPA-1911B |
Product Overview : | Recombinant Bacillus Pumilus (strain SAFR-032) ZAPA Protein (1-85 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Pumilus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-85 aa |
Description : | Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.9 kDa |
AA Sequence : | MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | zapA; Z ring-associated protein ZapA; |
UniProt ID | A8FG14 |
◆ Recombinant Proteins | ||
ZAPA-1982P | Recombinant Human ZAPA Protein (17-491 aa), His-SUMO-tagged | +Inquiry |
ZAPA-1911B | Recombinant Bacillus Pumilus ZAPA Protein (1-85 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZAPA Products
Required fields are marked with *
My Review for All ZAPA Products
Required fields are marked with *
0
Inquiry Basket