Recombinant Bacillus subtilis sboA protein
Cat.No. : | sboA-4330B |
Product Overview : | Recombinant Bacillus subtilis sboA protein(O07623)(9-43aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Bacillus subtilis |
Tag : | N/A |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 3.4 kDa |
Protein length : | 9-43aa |
AA Sequence : | NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Products Types
◆ Recombinant Protein | ||
sboA-4331B | Recombinant Bacillus subtilis sboA protein, His-KSI-tagged | +Inquiry |
SBOA-0105B | Recombinant Bacillus subtilis SBOA protein, His-tagged | +Inquiry |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All sboA Products
Required fields are marked with *
My Review for All sboA Products
Required fields are marked with *
0
Inquiry Basket